PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.F02114.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family M-type_MADS
Protein Properties Length: 97aa    MW: 10875.6 Da    PI: 8.0055
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.F02114.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF51.99.4e-17748142
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                    k ien+  r v fskR +g+lKKA+ELS+LC+a v  ++ s 
  Pahal.F02114.1  7 KLIENEEARRVCFSKRCQGLLKKASELSILCGAMVVSVVSSL 48
                    569*******************************98888775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.8E-11158IPR002100Transcription factor, MADS-box
PROSITE profilePS5006617.156156IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-11121IPR002100Transcription factor, MADS-box
CDDcd001203.43E-17255No hitNo description
SuperFamilySSF554553.66E-16255IPR002100Transcription factor, MADS-box
PfamPF003196.2E-18947IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-112136IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-113657IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 97 aa     Download sequence    Send to blast
MQRIEFKLIE NEEARRVCFS KRCQGLLKKA SELSILCGAM VVSVVSSLED VIDHFTILVM  60
ESHASSSHDS GGVVADTVHK LNIEHSKLQH CWRLRR*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002459568.12e-23hypothetical protein SORBIDRAFT_02g006710
TrEMBLC5XDF32e-23C5XDF3_SORBI; Putative uncharacterized protein Sb02g006710
STRINGSb02g006710.15e-23(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57390.14e-13AGAMOUS-like 18